SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015319 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015319
Domain Number 1 Region: 63-113
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000366
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015319   Gene: ENSMMUG00000019164   Transcript: ENSMMUT00000016349
Sequence length 229
Comment pep:known chromosome:MMUL_1:X:46276936:46290961:1 gene:ENSMMUG00000019164 transcript:ENSMMUT00000016349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDDAFARRPRVGAQIPEKIQKHPWRQVCDRALHLVTLTPFRKVGREPASSVKALLCGR
GEARAFDDIAKYFSKKEWERMKVSEKIVYVYKKRKYEAMSKLGFKVTLPPFMRNKRATDF
QGNDSDNDPNHGNQVEHPQMTSGRLQGIFPKIMPEKPAEEGNDSKGVPEASGPQNDVKQL
CPPGKPSTSEKINKRSGPKTGKHAWTHRLRERKQLVIYEEISDPEEDDE
Download sequence
Identical sequences ENSMMUP00000015319 9544.ENSMMUP00000015319 ENSMMUP00000015319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]