SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015779 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015779
Domain Number 1 Region: 20-360
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.7e-69
Family ADP-ribosylglycohydrolase 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015779   Gene: ENSMMUG00000012030   Transcript: ENSMMUT00000016849
Sequence length 364
Comment pep:known chromosome:MMUL_1:1:38928110:38933117:1 gene:ENSMMUG00000012030 transcript:ENSMMUT00000016849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAMAVAGGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVELTSVLRHVQSLEP
DPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGV
VTVFKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQL
THASSLGYNGAILQALAVHLALQGESSSKHFLKQLLGHMEELEGDAQSVLDARELGMEEH
PYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPDPEIPSAFNS
LQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDILAQSLHRVF
QKSL
Download sequence
Identical sequences A0A096N3D8 A0A2K5NRZ4 A0A2K5ZXM8 A0A2K6JP27 A0A2K6P5D1 F7GY61 G7NTI0
ENSMMUP00000015779 ENSMMUP00000015779 9544.ENSMMUP00000015779 XP_001110060.1.72884 XP_005544036.1.63531 XP_010358720.1.97406 XP_011844385.1.47321 XP_011934878.1.92194 XP_017740037.1.44346 ENSPANP00000006850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]