SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020979 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020979
Domain Number 1 Region: 12-482
Classification Level Classification E-value
Superfamily ALDH-like 2.43e-134
Family ALDH-like 0.0000000000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020979   Gene: ENSMMUG00000015946   Transcript: ENSMMUT00000022424
Sequence length 486
Comment pep:known chromosome:MMUL_1:1:195505693:195545048:-1 gene:ENSMMUG00000015946 transcript:ENSMMUT00000022424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPATGRVIATFTCSGEKEVNLAVQNAKA
AFKIWSKKSGMERCRILLEAARIIREREDEIATVECINNGKSIFEARLDIDTSWQCLEYY
AGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFK
PSPFTPVSALLLAEIYTEAGVPPGLFNVVQGGAATGQFLCQHHDVAKVSFTGSVPTGMKI
MEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEI
LDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQTLKILICVKHW
VRCLLKTHMSRNLETCKYINCGQPSTALKERLRSCSFDLSTEQLERWVTPMCCSFFLRDI
QRAHRVVAELQAGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMG
DVESAF
Download sequence
Identical sequences 9544.ENSMMUP00000020979 ENSMMUP00000020979 ENSMMUP00000020979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]