SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021946 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021946
Domain Number 1 Region: 52-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 2 Region: 124-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000615
Family LDL receptor-like module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021946   Gene: ENSMMUG00000016695   Transcript: ENSMMUT00000023456
Sequence length 280
Comment pep:known chromosome:MMUL_1:19:8245511:8246211:-1 gene:ENSMMUG00000016695 transcript:ENSMMUT00000023456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSGWMARGGAQRTGALGLALRLLLGLGLGLEVAATPLSTRTSAQASGPSSGSCPPTKFQC
RTSGLCVPLTWRCDRDFDCSDGSDEEECRIEPCTQNGQCPPPPGLPCPCTGVSDCSGRTD
KKLRNCSRPACPAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTHLRGPGAVAHTC
NPSTLGGRGSLRDATTTGPPATPESVTSVGNVTSSSAGDQSGSSGVYGVIAAAAVLSASL
VAVTLLLLSWLRAQERLRPLGLLVAMKESLLLSERKTSLP
Download sequence
Identical sequences ENSMMUP00000021947 ENSMMUP00000021946 9544.ENSMMUP00000021947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]