SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028723 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028723
Domain Number 1 Region: 196-489
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 5.76e-98
Family Cryptochrome/photolyase FAD-binding domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 5-214
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.96e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028723   Gene: ENSMMUG00000021808   Transcript: ENSMMUT00000030689
Sequence length 586
Comment pep:known chromosome:MMUL_1:11:108062958:108165675:-1 gene:ENSMMUG00000021808 transcript:ENSMMUT00000030689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGINYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSTENIPGCSSSGSCSQGSGILHYT
HGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Download sequence
Identical sequences A0A096NGF3 A0A2K5MP50 A0A2K6DUM1 F7ENG9 G7PI44
9544.ENSMMUP00000028723 ENSMMUP00000028723 NP_001181088.1.72884 XP_005572176.1.63531 XP_005572177.1.63531 XP_011767252.1.29376 XP_011767253.1.29376 XP_011767254.1.29376 XP_011767255.1.29376 XP_011887949.1.92194 XP_011887950.1.92194 XP_015008131.1.72884 ENSMMUP00000028723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]