SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029520 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029520
Domain Number 1 Region: 137-264
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-22
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 2-24,73-141
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-22
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029520   Gene: ENSMMUG00000022429   Transcript: ENSMMUT00000031549
Sequence length 311
Comment pep:known chromosome:MMUL_1:1:223313750:223366672:-1 gene:ENSMMUG00000022429 transcript:ENSMMUT00000031549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEA
SNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFT
LLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSV
LEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLE
TFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQ
SSACADGPANH
Download sequence
Identical sequences 9544.ENSMMUP00000029520 ENSMMUP00000029520 ENSMMUP00000029520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]