SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383770514|ref|YP_005449577.1| from Bradyrhizobium sp. S23321

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383770514|ref|YP_005449577.1|
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.32e-44
Family TK-like Pyr module 0.033
Further Details:      
 
Domain Number 2 Region: 171-303
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.68e-25
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383770514|ref|YP_005449577.1|
Sequence length 307
Comment transketolase domain-containing protein [Bradyrhizobium sp. S23321]
Sequence
MRTTFIDSLSQAASENPDIWLLCGDLGYSVLEPFAAKFPDRFINVGVAEQNMAGMAAGIA
LSGKTVFIYSIGNFPTLRCLEQLRNDVCYHGADVKVVAVGAGYAYGSQGYTHHALEDAGI
MSMLPGIEVFVPCDPMEVRAATRLIAGSGKPSYLRLSRQGEPNLGAVVTDPRKPRVLREG
REVVILASGPIASRALEAAGELAGRGREVGVMSVSCLKPLDEAAIRDAMLDASLIVTLEE
HILRGGLFSLVAGAYAGDAQRPPVAGIGIPEQGGKTSSAGSREALLDAAGLSVQAIVARI
EQSLAKR
Download sequence
Identical sequences I0G3X8
WP_015684794.1.47397 gi|383770514|ref|YP_005449577.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]