SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94309117|ref|YP_582327.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94309117|ref|YP_582327.1|
Domain Number 1 Region: 4-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.16e-102
Family Methylenetetrahydrofolate reductase 0.000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94309117|ref|YP_582327.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Cupriavidus metallidurans CH34]
Sequence
MTDRYFSFEFFPPKTAEGAEKLRNTRAQLAPLQPKYISVTFGAGGTTQQGTLDAVLEIQR
EGIEAAPHLSCVGSTRDSIRQILQTYRDGGIRHIVALRGDMPSGMGEIGEFRYANELVEF
IRAETGDWFNIEVAAYPEYHPQARSPRHDLENFVRKVKAGADSAITQYFFNADAYFRFVD
DVRAMGVEVPIVPGIMPITNYSQLMRFSEMCGAEVPRWVAKRLESFGDDKEAIRAFGLDV
VTDLCTRLLEAGVPGLHFYTLNAAGATKAIWQRLKL
Download sequence
Identical sequences A0A132HDK2 Q1LS18
266264.Rmet_0172 WP_011515081.1.12480 WP_011515081.1.25839 WP_011515081.1.481 WP_011515081.1.52493 WP_011515081.1.66126 gi|94309117|ref|YP_582327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]