SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94311748|ref|YP_584958.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94311748|ref|YP_584958.1|
Domain Number 1 Region: 120-287
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.98e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 410-551
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.77e-40
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00059
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.54e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Domain Number 4 Region: 252-276,315-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.06e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94311748|ref|YP_584958.1|
Sequence length 560
Comment sulfite reductase, subunit beta (hemoprotein with two 4Fe-4S domains) [Cupriavidus metallidurans CH34]
Sequence
MYQYDQYDQRIVQERVAQFRDQVRRRLSDELTEEEFLPLRLQNGLYMQRHAYMLRVAIPY
GLLASKQMRMLAHIARTYDRDYGHFSTRQNIQYNWMDLERVPDVLDDLASVEMHGIQTSG
NCVRNITTDQFAGVAPDETVDPRVLAELLRQWSTFQPEFAFLPRKFKIAISSSADDRAVV
QMHDIGIYAYKNAAGETRLRILAGGGLGRTPILGTIIKEDLPWQHMLTYVESAIRVYNRY
GRRDNKYKARIKILVKAIGAEKFAAEVEEEWKFSKDGPGTLTQAEFDRVAQYFQPPAYEK
LPDTDASFEKHLLENKAFARWVNRNVHAHKVPGYASVTLSTKPGPVSPPGDATSAQMDTV
ADFADRYGYGELRVAHEQNLVLPDVKKRDLFALWEDAKKAGLATANIGLLTDIIACPGGD
FCSLANAKSIPIALAIQERFDNLDYVYDLGDISLNISGCINACGHHHVGNIGVLGVDKDG
AEWYQVTIGGAQGNDTALGKVIGPSFSAHEMPDVVSRIIETFVANRVGDERFIETVGRIG
IAPFKERVYADKQREERAEA
Download sequence
Identical sequences A0A132HFM9 L2EK37 Q1LJI7
266264.Rmet_2816 WP_008644114.1.12480 WP_008644114.1.25839 WP_008644114.1.481 WP_008644114.1.63697 WP_008644114.1.64716 WP_008644114.1.66126 gi|94311748|ref|YP_584958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]