SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94312160|ref|YP_585370.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312160|ref|YP_585370.1|
Domain Number 1 Region: 21-294
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.71e-94
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000321
Further Details:      
 
Domain Number 2 Region: 295-317,364-452
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 4.49e-23
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94312160|ref|YP_585370.1|
Sequence length 467
Comment cytochrome b subunit, Ubiquinol-cytochrome-c reductase [Cupriavidus metallidurans CH34]
Sequence
MAAEKEVKTTGLLGWIDARFPATQLWEDHLSKYYAPKNFNFWYFFGSLALLVLVIQIVTG
IFLVMNYKPDGTLNAAGIPVAFASVEFIMREVPWGWLIRYMHSTGASAFFVVVYLHMFRG
LLYGSYRKPRELVWIFGCLIFLCLMAEAFMGYLLPWGQMSYWGAQVIVNLFSAIPVIGQD
LSLFIRGDYVVSDATLNRFFSFHVIAVPLVLLGLVVAHIIALHEVGSNNPDGVEIKAKKD
ENGIPLDGIPFHPYYSVHDLLGVAGFLIIFSAVIFFFPEVGGYFLEANNFFPADPLKTPP
HIAPVWYFTPFYSMLRATTANFLPILWAFFAIVLGMVFLRTKDARIKMGSVAILVILAVG
FYFIDAKFWGVLVMGGSVIVLFFMPWLDCSPVKSIRYRPAFHKTILVVFVVVFLILGYLG
VQPPSPVGEKVSQLGTLLYFAFFLTMPLWSRAGTFKPVPERVTFHPH
Download sequence
Identical sequences A0A132HT13 A0A2A4MEF5 Q1LIC5
266264.Rmet_3229 WP_011517711.1.12480 WP_011517711.1.22474 WP_011517711.1.25839 WP_011517711.1.38154 WP_011517711.1.481 WP_011517711.1.52493 WP_011517711.1.66126 gi|94312160|ref|YP_585370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]