SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94312206|ref|YP_585416.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312206|ref|YP_585416.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.93e-31
Family Frataxin-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94312206|ref|YP_585416.1|
Sequence length 111
Comment frataxin-like protein [Cupriavidus metallidurans CH34]
Sequence
MPPLSESEFLALASKALDQLEAAIEAAADAADADVEINRTGNVMELEFEDGSKIIVNSQA
PMQELWVAAKAGGFHFRNDGSKWVDTRGGGELYAALSGYMSQQAGVTLTLK
Download sequence
Identical sequences A0A132HT66 Q1LI79
266264.Rmet_3275 3694.eugene3.153200002 gi|94312206|ref|YP_585416.1| WP_011517748.1.12480 WP_011517748.1.25839 WP_011517748.1.481 WP_011517748.1.52493 WP_011517748.1.63697 WP_011517748.1.66126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]