SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94312420|ref|YP_585630.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312420|ref|YP_585630.1|
Domain Number 1 Region: 636-1113
Classification Level Classification E-value
Superfamily ALDH-like 7.59e-129
Family ALDH-like 0.000000316
Further Details:      
 
Domain Number 2 Region: 263-618
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.9e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000209
Further Details:      
 
Domain Number 3 Region: 89-262
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.96e-65
Family N-terminal domain of bifunctional PutA protein 0.000000135
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000122
Family PutA pre-N-terminal region-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94312420|ref|YP_585630.1|
Sequence length 1320
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Cupriavidus metallidurans CH34]
Sequence
MATTTLGVKLDDASRERLKRVAQSIDRTPHWLIKQAIFTYLEQVERGHLPHEAGAGATAD
TDGADAGDATQADAAPQPFLEFAQSVQPQSVLRAAITSAYRRPETECVPVLLEQARLPQA
QADAAIKMARALAARLREQKVGSGREGLVQGLIQEFSLSSQEGVALMCLAEALLRIPDKA
TRDALIRDKISGANWQSHLGQSPSLFVNAATWGLLLTGRLVATHTEAGLSKALTRIIGKG
GEPLIRKGVDMAMRLMGEQFVTGETISEALANARKYEEEGFRYSYDMLGEAAMTEADAQR
YLASYEQAIHAIGQASRGRGIYEGPGISIKLSALHPRYSRAQHERVITELYGRLKSLTML
ARQYDIGINIDAEEADRLEISLDLLERLCFEPELAGWNGIGFVVQGYQKRCPFVIDYLID
LARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKVYTDVSYVACARKLLSVPDA
IYPQFATHNAHTLAAIYQIAGQNYYPGQYEFQCLHGMGEPLYDQVVGPVADGKFNRPCRI
YAPVGTHETLLAYLVRRLLENGANTSFVNRIADETIALDDLVADPVAVVETMHKTEGVLG
LPHPRIPQPRALYGKSRANSAGIDLSNEHRLASLSSALLAGTSETPRAEPLLGAAVAGTD
ATSEPVLNPADRRDVVGQVSEATPAETEAALVAAVNVAPIWQATPPEVRAAALERAADLM
EAQMQSLMGIIMREAGKTFSNAIAEVREAVDFLRYYAVQVRASFSNDTHRPLGPVVCISP
WNFPLAIFTGQVAAALAAGNPVLAKPAEQTPLIAAAAVRLLRDAGVPAAAVQLLPGRGET
VGAALVGDARVKGVMFTGSTEVARLLQRNVASRLDAAGRPIPLIAETGGQNAMIVDSSAL
AEQVVGDVVTSAFDSAGQRCSALRVLCLQEDVADRILEMLKGAMGELTLGNPDRLSTDVG
PVIDEEARGNILRHIEAMRAKGRRVHQADPGAADTPACRHGTFVPPTLIELDSIAELKRE
VFGPVLHVVRFPRTALDKLIDQINGTGYGLTLGVHTRIDETIAHIVDRADVGNLYVNRNV
VGAVVGVQPFGGEGLSGTGPKAGGPLYLHRLLSVCPQDAVARAVRASDATGGVAAAPVSP
ELAALKAWAQASLPEVAEACDRLAAASPSGLGVTLPGPTGERNTYSLLPRERVLCLAQQE
SDLVLQLAAVLAVGSEALCVDTAQTRALSERLPAAVQSRVRMVSDWTSTDTAFDAVLHHG
DSDQLRTVCEQVATRTGPIVGVQGLAHGEPNIALERLLIERSLSVNTAAAGGNASLMTIG
Download sequence
Identical sequences A0A132HAC7 Q1LHL5
266264.Rmet_3489 WP_011517917.1.12480 WP_011517917.1.25839 WP_011517917.1.481 WP_011517917.1.52493 WP_011517917.1.66126 gi|94312420|ref|YP_585630.1| NYSGRC-FDAO-ABF10361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]