SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94313740|ref|YP_586949.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94313740|ref|YP_586949.1|
Domain Number 1 Region: 629-805
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.79e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 1-187
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.73e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0038
Further Details:      
 
Domain Number 3 Region: 498-637
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.49e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.019
Further Details:      
 
Domain Number 4 Region: 144-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.02e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94313740|ref|YP_586949.1|
Sequence length 853
Comment assimilatory nitrite reductase (NAD(P)H-binding) large subunit [Cupriavidus metallidurans CH34]
Sequence
MKIIIVGHGMVGHKFLECLADAGAKDLDVTVLCEEPRPAYDRVHLSEFFAGKSAEDLSLV
PEGFFAQHNNMLLRLNAKATAIDTAAKTVTTATGETLGYDKLVLATGSYPFVPPLPGKDR
KDTFVYRTIEDLEAMLECGQRATSGVVIGGGLLGLECAKALRDMGLQTHVVEFAPRLMAV
QVDDGGGRMLRQKIEELGVTAHTGKNTLEIVDGTEGTHRMNFADGTHLDTDMIVFSAGIR
PRDELARASGLTIGVRGGIVIDNNCLTSDPHVYAIGECALWDGKIYGLVAPGYDMARVAA
RHLRGEASEFAGADMSTKLKLMGVDVASIGDPHGNEPGSRSYQFTDERKQIYKKLVVSEC
GKFLLGGVLVGDAAEYGTLLQMMLNRIELPESPEFLILPASDGKARPALGADALPDTAQI
CSCNNVSKGEICGAVCDGATTIGALKSCTKAGTACGGCVPLVTQIMKAEMKKQGMAVNNH
VCEHFPYSRQELYHLVRVGKFKSFDDLLAAHGSGLGCDICKPTVGSILASCWNEFVLKEE
HASLQDSNDYFLANIQKDGTYSVVPRMPGGEVTPDGLIAVGQIAKKYGLYTKITGGARVD
MFGARLEELPLIWEELIAAGFESGHAYGKSLRTVKSCVGSTWCRYGVDDSVGLAIDIENR
YKGLRAPHKIKFGVSGCTRECAEAQGKDVGIIATERGWNLYVCGNGGMKPRHAELLAGDL
DRETLIRYVDRFLMFYVRTADRLQRTSTWRDNLEGGLDYLKSVIIDDKLGIGAELEAEMQ
HVVDTYEDEWKRAVTDPETRKRFRHFVNSDLRDDNLMFLEERGQVRPATQEERNLQRSRL
SHIPVVAVPAKAA
Download sequence
Identical sequences Q1LDU6
266264.Rmet_4818 gi|94313740|ref|YP_586949.1|NC_007974 gi|94313740|ref|YP_586949.1| WP_011519243.1.12480 WP_011519243.1.25839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]