SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94313522|ref|YP_586731.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94313522|ref|YP_586731.1|
Domain Number 1 Region: 393-479
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000147
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94313522|ref|YP_586731.1|
Sequence length 492
Comment sulfate transporter [Cupriavidus metallidurans CH34]
Sequence
MMKSLRQDWLSNVRNDLLAGIVVALALIPEAIAFSIIAGVDPKVGLYASFSIAAIIAFAG
GRPGMVSAATGAMALLMVTLVKDHGLQYLLAATVLTGVLQILAGWLKLGALMRFVSRSVI
TGFVNALAILIFMAQLPELTNVTWHVYAMTAAGLGIIYGFPYITKAVPSPLVAIVVLTGV
AIFLGLDIRTVGDMGKLPDSLPVFLLPDVPLNLETLKIIFPVSATLAVVGLLESMMTASI
VDDLTDSNSNKNRECVGQGVANIATGFLGGMAGCAMIGQSVINVKSGGRGRLSTLAAGVF
LLLMVVFIGDWVARIPMAALVAVMIMVSIGTFNWASIRNLREHPKSSSMVMLATVVVTVG
THDLAKGVLIGVLLSGFFFAHKVGQILRVTSRTEDEGRVRTYTITGQVFFASADRFINTF
DYKEVIEKVRIDVSRAHFWDITAVSALDKVVIKFRREATEVEVIGLNEASATMVDKFAVH
DKDGAEDMLMGH
Download sequence
Identical sequences A0A0M2DW77 A0A1Y1J3K0 D0IY16 Q1LEG4
gi|94313397|ref|YP_586606.1|NC_007974 gi|94313522|ref|YP_586731.1|NC_007974 gi|264678649|ref|YP_003278556.1| 2000472510 gi|94313397|ref|YP_586606.1| gi|94313522|ref|YP_586731.1| GO.9233 266264.Rmet_4472 266264.Rmet_4600 688245.CtCNB1_2514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]