SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94314450|ref|YP_587659.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94314450|ref|YP_587659.1|
Domain Number 1 Region: 64-139
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-19
Family GntR-like transcriptional regulators 0.023
Further Details:      
 
Domain Number 2 Region: 159-288
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.88e-16
Family GntR ligand-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94314450|ref|YP_587659.1|
Sequence length 303
Comment GntR family transcriptional regulator [Cupriavidus metallidurans CH34]
Sequence
MWEAMLGARNAVEETLKCRMRHTLSDNICAEVDPMQDTPKMPTKTKPAVPDQQDPSPAGP
IFRRVRTRRAFEAVSDQIRQQLASGELRPGDRLPGERELAEQFTVSRSAVREALRSLEAA
SVVEARTGINGGFFIRSTSSTTGLTQTVQDLVSLGQVSIANVTEARVELMAVAIRLACAR
ATEEELDAIEADISYHTELFRQGDGSRNSKSVIEFYRLIAQATHNAVIVLMVDALSEIIR
KLLAQIAPEPRKDIMQVRRKVLTLLRQRDAQGACDAMATHLRHVSDYLESESKKSARKKK
IAA
Download sequence
Identical sequences Q1LBT6
266264.Rmet_5531 gi|94314450|ref|YP_587659.1|NC_007974 WP_011519935.1.12480 WP_011519935.1.25839 gi|94314450|ref|YP_587659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]