SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_00290 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00290
Domain Number 1 Region: 20-486
Classification Level Classification E-value
Superfamily TPR-like 1.12e-18
Family HAT/Suf repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_00290
Sequence length 544
Comment | SCRG_00290 | Saccharomyces cerevisiae RM11-1a U1 snRNP protein (544 aa)
Sequence
MDKYTALIHDENFSTLTLNVSRYPKSLAYWEKLLNYIVKASAPICKSTEPQLLKLIRCTY
SSMLNEFPYLENYYIDFALLEYKLGNVSMSHKIFQRGLQAFNQRSLLLWTSYLKFCNNVI
SHQKQLFKKYETAEEYVGLHFFSGEFWDLYLEQISSRCTSSKKYWNVLRKILEIPLHSFS
KFYALWLQRIDDIMDLKQLSQLTSKDELLKKLKIDINYSGRKGPYLQDAKKKLKKITKEM
YMVVQYQVLEIYSIFESKIYINYYTSPETLVSSDEIETWIKYLDYTITLQTDSLTHLNFQ
RALLPLAHYDLVWIKYSKWLINSKNDLLGAKNVLLMGLKFSLKKTEIIKLLYSVICKLNE
YVLLRNLLEKIESSYSDNVENVDDFEIFWDYLQFKTFCQNSLYSSRYSDSQSNGLLNKEL
FDKVWKRLSCKEKKSGQEILLNNLVQFYSKDTVEFVEKNIFQKIIESGWQYYLQNGMFWN
CYCRLIYFDTSRSYLDKRQYIVRKIWPQIDKKFAQSVLPSLTEFCQSYFPEEMDTLEEMF
TEEP
Download sequence
Identical sequences B3LG53 B5VGC2
SCRT_00290 YDR235W YDR235W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]