SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_00824 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00824
Domain Number 1 Region: 465-561
Classification Level Classification E-value
Superfamily TPR-like 0.0000059
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Weak hits

Sequence:  SCRT_00824
Domain Number - Region: 494-531,638-713
Classification Level Classification E-value
Superfamily TPR-like 0.00797
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_00824
Sequence length 817
Comment | SCRG_00824 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (818 aa)
Sequence
MPNSNVRIPPTVPSKIIDVVDQALRARLLGGSTFNSGFDSLDSVLNLQFRLHYHVIGSNG
PAKPVCDVLLKESQNLEKNMSMMEELNDYPEITKLVEKILFNCLAILFFHRGQFQESQRC
LLHSLKIHNNTASQRTALMEQYDRYLIVENLYYRGLVSQDINIMQNVFYKELLAHVDTVP
PESNGLLFEYISLIVAKLRFNQIQDLAENFKTTVENPFILFLYMIKKFQSPLKKHIDNDD
LYLKFGQNVLLKAKFPTASETNDEALEHFNVFLQYYFKFTHIKKIKVTPSWYNFIISSME
KTFQSIEVSKTAMFLFQNLSDNSNDEIKKKTFKRESILNFVNFVKYNDKYYQLHDNSHRD
IISFIDAYSFILQNSSKTDSIENVFDYDNTVSTFATSLNSFYKEYNLPLMSQSESLDWLE
NSTRCVYPGNISKVLTNAWSTLYEIRKYQLDFLVSNNLTSYLCNAMMLSTKEKDNADVEE
QEEGEEEKALRELQFKYSYTLAQQRHIETAIKTLESLILSKNPNYYKAWHLLALCRSVQE
DKEMSYKIVCSVLEAMNESLQNNTLLLNDRWQFIHLKLTQLALIEEILGTLEALETLPEV
FELYATLFPDSQPKLNSMGPKYSQTKEYLLQMVWIFAANMYMRTKDNDEDAKAAIKEASN
VESKFKNLNCNIANGYLSIIKDEPGVALKEFETVLYYDENNLDALVGFAELIFPEELGVE
ETNLERYYTLSLDKKPGKRAKLTFVNDTDRSAAYARLKFLLECAILESIEAYYSPEVWWY
LSLIYEKYQDDEYKNSLLKCIKYQELNPIRSLRYCNY
Download sequence
Identical sequences B3LI39
YGR198W SCRT_00824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]