SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_00991 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00991
Domain Number 1 Region: 38-471
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.58e-86
Family GABA-aminotransferase-like 0.0000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_00991
Sequence length 471
Comment | SCRG_00991 | Saccharomyces cerevisiae RM11-1a 4-aminobutyrate aminotransferase (472 aa)
Sequence
MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDV
DGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDRPALGNFPSKDLDKILKQILK
SAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGYDADFSEKENLSVMDNDAPGAPHL
AVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDR
CLAIVEELIKTWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG
VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARMI
IAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENFQNLRGKGRGTFIAWDLPTGE
KRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEALAKSVNEL
Download sequence
Identical sequences A0A0L8VQC5 A0A250WC99 A6ZV09 B3LIJ9 B5VIY0 C7GK87 E7NHT5 E7Q400 E7QEZ1 G2WEB0
YGR019W tr|A6ZV09|A6ZV09_YEAS7 YGR019W YGR019W YGR019W SCRT_00991 YGR019W YGR019W YGR019W YGR019W YGR019W YGR019W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]