SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_01854 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01854
Domain Number 1 Region: 77-484
Classification Level Classification E-value
Superfamily TPR-like 2.28e-26
Family HAT/Suf repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_01854
Sequence length 629
Comment | SCRG_01854 | Saccharomyces cerevisiae RM11-1a pre-mRNA processing protein PRP39 (630 aa)
Sequence
MPDETNFTIEDIEPRPDALRGLDTQFLHDNTALVQAYRGLDWSDISSLTQMVDVIEQTVV
KYGNPNDSIKLALETILWQILRKYPLLFGFWKRFATIEYQLFGLKKSIAVLATSVKWFPT
SLELWCDYLNVLCVNNPNETDFIRNNFEIAKDLIGKQFLSHPFWDKFIEFEVGQKNWHNV
QRIYEYIIEVPLHQYARFFTSYKKFLNEKNLKTTRNIDIILRKTQTTVNEIWQFESKIKQ
PFFNLGQVLNDDLENWSRYLKFVTDPSKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWL
TKKNISDEVVVDIYQKANTFLPLDFKTLRYDFLRFLKRKYRSNNTLFNNIFNETVSRYLK
IWPNDILLMTEYLCMLKRHSFKNSLDQSPKEILEKQTSFTKILETSISNYINNQIDAKVH
LQTLINDKNLSIVVVELIKTTWLVLKNNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKS
NVNFTKLNKFIRELGVEIYLPTTVMNDILTDYKTFYLTHSNIVTYESSIIDSNTFDPILY
PELKMSNPKYDPVLNTTANVDWHKKTEWKEAGHIGITTERPQISNSIIECNSGTLIQKPI
SLPNFRNLEKINQVKMNDLYTEEFLKEGK
Download sequence
Identical sequences A0A0L8VK05 A6ZM21 B3LLL1 B5VP84 E7QIZ4
SCRT_01854 YML046W YML046W YML046W YML046W YML046W YML046W tr|A6ZM21|A6ZM21_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]