SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_01914 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01914
Domain Number 1 Region: 202-506
Classification Level Classification E-value
Superfamily TPR-like 9.1e-71
Family Tetratricopeptide repeat (TPR) 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_01914
Sequence length 514
Comment | SCRG_01914 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (515 aa)
Sequence
MNEVTCSITGDNPIHKINNGLGLKWNNLGKFSDFQTNDSAARDARTIDYIFTNCQTGSSI
GKIDFRAALPADKSQHSGVSEKEFSRLENQWSKEFSCFPKNKNADVTKPSRNKHEKRSAN
LHNRYFAQYYSTAYQQNRIYPCRISYNEHSSVSNGWEFQFKSIENQLLNELKIENNVEEK
TVGYEYVAEYEETIDFMHMLSSVPQTYQFLKSNIYITERDPYKIGCVLMDNGSNLNEVVM
AFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHHINQ
QNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPKKAHLVHILESLLNMGIEKKDQY
DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC
KQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILLRSKGYEHNKAKMQNKFMQNLKNA
LIASKNFDSLDLINGSHNTESLISTLKAIYNKMD
Download sequence
Identical sequences A0A0L8VJX9 A0A250WEP7 B3LLS0 B5VPE5 C8ZEM6 G2WK69
YMR018W YMR018W YMR018W YMR018W YMR018W SCRT_01914 YMR018W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]