SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_01953 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01953
Domain Number 1 Region: 33-580
Classification Level Classification E-value
Superfamily TPR-like 1.71e-80
Family HAT/Suf repeat 0.000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_01953
Sequence length 677
Comment | SCRG_01953 | Saccharomyces cerevisiae RM11-1a mRNA 3'-end processing protein RNA14 (678 aa)
Sequence
MSSSTTPDLLYPSADKVAEPSDNIHGDELRLRERIKDNPTNILSYFQLIQYLETQESYAK
VREVYEQFHNTFPFYSPAWTLQLKGELARDEFETVEKILAQCLSGKLENNDLSLWSTYLD
YIRRKNNLITGGQEARAVIVKAFQLVMQKCAIFEPKSSSFWNEYLNFLEQWKPFNKWEEQ
QRIDMLREFYKKMLCVPFDNLEKMWNRYTQWEQEINSLTARKFIGELSAEYMKARSLYQE
WLNVTNGLKRASPINLRTANKKNIPQPGTSDSNIQQLQIWLNWIKWERENKLMLSEDMLS
QRISYVYKQGIQYMIFSAEMWYDYSMYISENSDRQNILYTALLANPDSPSLTFKLSECYE
LDNDSESVSNCFDKCTQTLLSQYKKIASDVNSGEDNNTEYEQELLYKQREKLTFVFCVYM
NTMKRISGLSAARTVFGKCRKLKRILTHDVYVENAYLEFQNQNDYKTAFKVLELGLKYFQ
NDGVYINKYLDFLIFLNKDSQIKTLFETSVEKVQDLTQLKEIYKKMISYESKFGNLNNVY
SLEKRFFERFPQENLIEVFTSRYQIQNSNLIKKLELTYMYNEEEDSYFSSGNGDGHHGSY
NMSSSDRKRLMEETGNNGNFSNKKFKRDSELPTEVLDLLSVIPKRQYFNTNLLDAQKLVN
FLNDQVEIPTVESTKSG
Download sequence
Identical sequences A0A250WEW4 A6ZMC0 B3LLV4 E7QJ65 G2WKA9 H0GKY4 N1NX83 P25298
YMR061W 354958 YMR061W SCRT_01953 YMR061W YMR061W YMR061W YMR061W 4932.YMR061W YMR061W YMR061W NP_013777.1.97178 YMR061W YMR061W tr|A6ZMC0|A6ZMC0_YEAS7 YMR061W YMR061W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]