SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_02289 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02289
Domain Number 1 Region: 113-152,182-265
Classification Level Classification E-value
Superfamily TPR-like 0.00000000167
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_02289
Sequence length 640
Comment | SCRG_02289 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to signal recognition particle protein (641 aa)
Sequence
MAKDNLTNLLSQLNIQLSQDEHSQVEQTCVKLLDSGCENPADVFRRCLVAVIQQDKYQKA
LHYLKKFKHIDDKYGRKFALEKLYIFYKLNMPDEFNTLYTAIITDDLDTVLKKDIESLRG
ILHVRAQYCYKNGLYQEAFKIYQHLASHNEKDQDSQIELSCNERVPLSVATELMNRSPLV
TPMDESSYDLLFNESFIMASVGKYDKAIELLEKALQGATNEGYQNDINTIKLQLSFVLQM
VGKTAQSKEILKGLLQELKADSPFSLICQNNLNAFVDFSKYNTNFNLLLRELNVEKLNTF
NLQTFTHEQWSNIQRNVLFLRLFNNVKIHSQESLLSRTFDKYSKLVDNVTLESYKTQAKK
LYHHTTKTILSGTDGSTIGILLLTIQLLIIEKEWENAIRIGELFLNESWKSSFEKFNDSQ
AIVCYILFELYKIKGRNNSKSVLLKKLGSVRVQLSGKIQENIPFWKHVGFELLSMGNAKE
SKALLREISNFSKGDADVLVDRVVSSDSLDIAQGIDLVRDIDIDKLIQLGVKPLESSAKR
SKNTAVSKVQKRKVLELKKKRKIKRLEKFLQGRDTSKLPDPERWLPLRDRSTYRPKKKQQ
GAKQTQGGAMNKKSEQALDISKKGKPTVNKKPKNKKKGRK
Download sequence
Identical sequences A0A0L8VHF5 A6ZW45 B3LKM0 C8ZIG9 N1NW93 P38688
YPL210C NP_015114.2.97178 SCRT_02289 YPL210C 4932.YPL210C YPL210C YPL210C YPL210C YPL210C YPL210C YPL210C tr|A6ZW45|A6ZW45_YEAS7 YPL210C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]