SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_02596 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02596
Domain Number 1 Region: 5-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.2e-119
Family IF2B-like 0.000000000000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_02596
Sequence length 411
Comment | SCRG_02596 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to methylthioribose-1-phosphate isomerase (412 aa)
Sequence
MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVG
SLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIK
NILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTI
CNTGSLATSGYGTALGVIRSLWKDSLAKTDKADSGLDNEKCPRMGHVFPLETRPYNQGSR
LTAYELVYDKIPSTLITDSSIAYRIRTSPIPIKAAFVGADRIVRNGDTANKIGTLQLAVI
CKQFGIKFFVVAPKTTIDNVTETGDDIIVEERNPEEFKVVTGTVINPENGSLILNESGEP
ITGKVGIAPLEINVWNPAFDITPHELIDGIITEEGVFTKNSSGEFQLESLF
Download sequence
Identical sequences A6ZWZ9 B3LK82 B5VTQ8 C8ZJE0 E7M171 E7NP13 N1P2B9 Q06489
SCRT_02596 tr|A6ZWZ9|A6ZWZ9_YEAS7 YPR118W YPR118W YPR118W YPR118w___KOG1468 YPR118W YPR118W YPR118W YPR118W YPR118W NP_015443.1.97178 YPR118W YPR118W YPR118W YPR118W YPR118W YPR118W 4932.YPR118W YPR118W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]