SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_02706 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02706
Domain Number 1 Region: 23-488
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.15e-174
Family GABA-aminotransferase-like 0.000000000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_02706
Sequence length 490
Comment | SCRG_02706 | Saccharomyces cerevisiae RM11-1a serine hydroxymethyltransferase, mitochondrial precursor (491 aa)
Sequence
MFPRASALAKCMATVHRRGLLTSGAQSLVSKPVSEGDPEMFDILQQERHRQKHSITLIPS
ENFTSKAVMDLLGSELQNKYSEGYPGERYYGGNEIIDKSESLCQARALELYGLDPAKWGV
NVQPLSGAPANLYVYSAIMNVGERLMGLDLPDGGHLSHGYQLKSGTPISFISKYFQSMPY
HVDHTTGLIDYDNLQVLAKAFRPKVIVAGTSAYSRLIDYARFKEISQGCGAYLMSDMAHI
SGLVAANVVPSPFEHSDIVTTTTHKSLRGPRGAMIFFRKGIKSVTKKGKEIPYELEKKIN
FSVFPGHQGGPHNHTIGAMAVALKQAMSPEFKEYQQKIVDNSKWFAQELTKMGYKLVSGG
TDNHLIVIDLSGTQVDGARVETILSALNIAANKNTIPGDKSALFPSGLRIGTPAMTTRGF
GREEFSQVAKYIDSAVKLAENLKTLEPTTKLDARSRLNEFKKLCNESSEVAALSGEISKW
VGQYPVPGDI
Download sequence
Identical sequences A0A0L8VUR7 A6ZLK3 B3LMP8 C7GMW7 D3UF11 E7K9L0 E7LRR4 E7NF59 E7Q159 H0GCV7 N1P767 P37292
4932.YBR263W YBR263W YBR263W YBR263W YBR263W YBR263W YBR263W YBR263W YBR263W SCRT_02706 YBR263W NP_009822.4.97178 YBR263W YBR263W YBR263W YBR263W YBR263W tr|A6ZLK3|A6ZLK3_YEAS7 YBR263W YBR263W YBR263W YBR263W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]