SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_03438 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03438
Domain Number 1 Region: 634-739,792-827
Classification Level Classification E-value
Superfamily TPR-like 3.16e-17
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Weak hits

Sequence:  SCRT_03438
Domain Number - Region: 515-591
Classification Level Classification E-value
Superfamily TPR-like 0.00569
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_03438
Sequence length 904
Comment | SCRG_03437 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to NO364 (905 aa)
Sequence
METLLHTKLLLSAEVESLKSGSFDQTYVKKAEHIISGESYQLVQQFVDKFKGKISISGEI
STSSVIAALNDFLNVEVFKMGQENEMLFLAIAFLQTFIQNNYTGPAARLEAISGLFGKTG
IEIGAVNTALSRSLAIMGQPAYEFMDDPLYMVLSLLLLERITGQKSLFDVTPDQEVPLPI
ISAESTPGLLAVAYWWWARALLTQLSLIPEPSGFQASVASAIYQSADLAYAITKELPENI
HEDFKRELYAMYYLENVKCSLAINTEHLCLPSLTRAKKITNFEFVMTGARATRTKYQQKA
HAGLIILAKSFTFQNFALRTTSATPETFALESDLLLEKPHFESIADEPLDEQIYSKRQKV
DLNEGYEEDKLLPLALRQENIPKLLLDLNPNDQPTLSDYDNIQLLLRLYTIKNTTPAKDP
LVEEELTALLSRILYQNGEKNWSIFARSLWERSIIETTKAKTIERGLLQMQSLVEELDLK
IKSKLVPSSNEINVASRLSYIHQLPFIPRWQLDATLAEKYMSLGILKSAVEIYERLGMAC
ETALCYAAVGDEKKAEEILLQRINENDSDARAYSILGDIKQDPSLWEKSWEIGKYVNAKN
SLAKYYFNPPPKSGVQPNYSATLKHLNDSLRQYPLSFETWYFYGCVGLQCGKMQIAAEAF
TRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQKNWKIWENYMLVAVKLN
EWEDVLTACKQLVSIRRDKSGEGSIDLPIIEKLVELLVTSEYPEEPQQLSYFQKSCTEFI
CNTLPQVITTSARCWRLVARVELWRKRPWAALECHEKAYRAISHNPDLEVEEKVWNDTVD
ACEDLVAAYESLGEMEGKYGPGSLVCKDWKYKCRSTIKALMSKGKGRWDDSPGWDRLVEA
RSQI
Download sequence
Identical sequences A0A0L8VI37 A6ZSG7 B3LPE7 E7QJI8
YNL313C YNL313C YNL313C YNL313C SCRT_03438 tr|A6ZSG7|A6ZSG7_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]