SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_04047 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04047
Domain Number 1 Region: 343-401
Classification Level Classification E-value
Superfamily TPR-like 0.00000569
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Weak hits

Sequence:  SCRT_04047
Domain Number - Region: 246-346
Classification Level Classification E-value
Superfamily ARM repeat 0.0144
Family BC3264-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_04047
Sequence length 765
Comment | SCRG_04046 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (766 aa)
Sequence
MSFLWGSTKSKKGKNKKAAGSLPSGVVPQQRVKPTRKNVPIDYPRTLEKVHGESLIFRTS
LLSELVSTGKSGIGPPDLIHCTELDKFHDEKIGEFFYITGIDASSVSMPIAFLKLIKWND
GKKLKSASLKNDDITTYCTFNIFQKLDIRLRYESEDVYQVNIVDCLNDNNEIPLSDLIWE
ETFVSCCIRSVIINSDFERKIPGLVELPFVFENRCASDYKRVIDSLCKFLPRFLECGWDS
TKSVYATILNNYLTESLLVFLSITPEFITDYAIQVLDNLMTNDPSNSRYYAIVIISIMER
SNDRDVEMIKRIHEILDLLLPVLYGLPSDEPYISDLINCITDVLSIQARFLLNNNDYELS
LSISTLATNLSSDNFESWYLLSKGYIFSQQYDKALLSINSMPCLAEYDIVKQAQINAFKF
YMNYYKAPLCHSREHCTMTSHELNHLMNIMHYENELELKTIIFGRTVMPNESKYGCIEEI
WNKSCLELGPICGPQSDNLINFVSQQEVNTVGDMLLLKRSKETRQESWFIKQVRLLLMEL
VARIGWNALLQLRSDVFVMESKFKMIESSDKLSTELRQKRLCQRWFDAMFLDVYEDLSIS
TSSQENKATAKYSGLEWELLGLTLLRVSDLPDAVACLRTSILARFDPISCHHLLNFYLTM
DFNDEFMRRFDVDIILDLLVKLISFRIRFYDRFQIFSLQVLRKLEGQLGSEIIKNKIINS
PYGQAGITSVIDYMLECLSKNRNEACLAYERPLPDLPSTIKPLAD
Download sequence
Identical sequences B3LRB1
SCRT_04047 YKR027W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]