SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_04113 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04113
Domain Number 1 Region: 256-618,709-763,790-887
Classification Level Classification E-value
Superfamily TPR-like 7.59e-53
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Weak hits

Sequence:  SCRT_04113
Domain Number - Region: 1026-1088,1115-1177
Classification Level Classification E-value
Superfamily PIN domain-like 0.0051
Family PIN domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_04113
Sequence length 1194
Comment | SCRG_04112 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (1195 aa)
Sequence
MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS
KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA
LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK
SEIVGGFQRKSNNSQEIKDKDNSARDQDFNNSGNNNNNNNHSSNNNDNNNNNNDDNNNDN
SNSRDNNNNSDDSNEREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLT
NSQTTELKSLWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVY
GSITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIA
LYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTP
SPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFI
EKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFEL
PKYLKERKDKKERKKSSNNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFLND
IDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLQKFLHGPLGIALPHILPWIYFII
SICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDEYD
KLSLSELLELFNEGEELPEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSP
TDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSL
VFKLEALCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKL
RADYTCFDKNGEFLSASLYTTWYVPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPEID
FKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGI
ITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESAS
EPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD
Download sequence
Identical sequences B3LRH1
SCRT_04113 YKR096W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]