SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_04189 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04189
Domain Number 1 Region: 61-584
Classification Level Classification E-value
Superfamily TPR-like 9.48e-54
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_04189
Sequence length 699
Comment | SCRG_04188 | Saccharomyces cerevisiae RM11-1a telomere elongation protein (700 aa)
Sequence
MDNEEVNEECMRIFFKNARAHLDKHLTSRLTCDENAYITFRCFLDGIHCKSTRFLEELLL
KQENMYHNNNYECINDSVIPLVLKLLWLQIHEPTLQWFEHWFHDIMRLSNRRKFRVFRIF
QKKMIQFFKITHRYYYDIIEHLCAKYDMNSVISNALFAKLNLMQYTDGLSTHEKIILNTS
NPLTFSIVISLQRCVINLGSTHFYKTLLNKPSNKPKSVEGFEKSIRYLNIASLYLPAVGD
TYFQRAKIYLITGKFSLYFFELVRGALVRIPSKCALNNLKDFILTPNFPERRRLMKKLAI
LVSKDLKGEKSFFEGQIVLQFLSIVEHTLVPQSWNASRASNCWLLKEHLQIAALKYHSGN
INVILENLAATMGSFDLMFTTRKSKEQKNKLKYADLSERQVFFLDLSFDFIANIIDVVIK
PSWQKNMEDFRYLAIIRLLMCWIKSYRSILQYTHRHKKFCTSFALLLNDLINSPLNCSGN
IYSHRPKRSYLFREDIIFREFSCINFALTDFNDDYVYDSPDMINNIIGCPTLTKMLSPKE
ECVLRIRSIIFSGMKFLEKNDTGVIWNASKHKFDLISPDIKMKRQIALSEISSKINVKTQ
QERVVSSRKVEAKRDEQQRKRAGKIAVTELEKQFANVRRTKKLSPLPEKDGVSSELVKHA
ASRGKKTITGPLSSDFLSYPDEAIDADEDITVQVPDTPT
Download sequence
Identical sequences A0A0L8VL06 B3RHC0 C7GR01 C8ZDJ7 H0GKF6
SCRT_04189 YLR233C YLR233C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]