SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_04936 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_04936
Domain Number 1 Region: 225-565
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.91e-40
Family Cystathionine synthase-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_04936
Sequence length 575
Comment | SCRG_04935 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (576 aa)
Sequence
MTEIEFGQPLPSNLDYAVSFGIPTWDSAIGYAEKVPEVIGKMATGYPRYFPQPPVQRLCA
YFVKKFGRGSENCRPFPSVNLGLNCLEYVKSVKGPESEAHLEVETVTIKNRGAKTSKEPA
ELVLTIAAVLASEEEFEIVKEYWKLRGECVSSRLALSVNQLLDCANHGSEQVLRELEAGV
FAAKKGEEKAKNLIKGRIVENRFKPFGLEKKTPNWEGLNLNPNEDVYLVSSGMSAISTAR
NLLTFWEEKKNLGDSLNKTTSDQKKKPLLCDTVGIFGFPFKDTQVIMTKFGKCKFFGFGN
SRDVVELQKFLETSKQRILAVFVETPSNPLLNMPDLKKLRRLADQYGFFIVIDDTIGGLN
VDILPYADIVSTSLTKLFNGASNVMGGSVVLNPKSSLYPYAREYFRSANFEDLLWCEDAI
VLERNSRDFEDRTLRANANTEKLLNDLLLPEEEKICKKIYYPTVTSKETFENYESVRNER
GGYGCLFSVAFFNEGDAKAFYDSLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGAD
PNIIRVSVGLEDIQWLLKVFSSALDVVKSRGSKHS
Download sequence
Identical sequences B3LTC0 E7QHL8 N1P213
YLL058W YLL058W SCRT_04936 YLL058W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]