SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_05074 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05074
Domain Number 1 Region: 116-590
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.88e-68
Family AAT-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_05074
Sequence length 592
Comment | SCRG_05073 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to alanine aminotransferase (593 aa)
Sequence
MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV
LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV
LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL
QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK
RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK
YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ
RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI
HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK
LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD
Download sequence
Identical sequences A7A0Z3 B3LT57 B5VN23 C7GQR2 E7KFH3 G2WIT1 P52893
YLR089c___KOG0258 SCRT_05074 YLR089C tr|A7A0Z3|A7A0Z3_YEAS7 YLR089C YLR089C YLR089C YLR089C NP_013190.1.97178 YLR089C YLR089C YLR089C YLR089C YLR089C YLR089C 4932.YLR089C YLR089C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]