SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_05100 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05100
Domain Number 1 Region: 55-542
Classification Level Classification E-value
Superfamily TPR-like 4.46e-60
Family HAT/Suf repeat 0.011
Further Details:      
 
Domain Number 2 Region: 516-644
Classification Level Classification E-value
Superfamily TPR-like 0.000000759
Family Tetratricopeptide repeat (TPR) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_05100
Sequence length 687
Comment | SCRG_05099 | Saccharomyces cerevisiae RM11-1a pre-mRNA splicing factor (688 aa)
Sequence
MDTLEPTAVDTHVSAEQILRDVYKKGQKARGSTNIDILDLEELREYQRRKRTEYEGYLKR
NRLDMGQWIRYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARN
LMNRAISTLPRVDKLWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQK
NWNGVREIYSKYVMAHPQMQTWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSD
MEVAKLVNSFAHWEAAQQEYERSSALYQIAIEKWPSNQLLKAGLLDFEKQFGDINSIEET
ISYKRKMEYETILSNNAYDYDTWWLYLDLISESFPKQIMQTFEKAIVDSRPKELSKNVQW
KRYIYLWMRYICYVELELENSLLEEELFQRLIDDIIPHKHFTFSKIWLMYAKFLIRHDDV
PKARKILGKAIGLCPKAKTFKGYIELEVKLKEFDRVRKIYEKFIEFQPSDLQIWSQYGEL
EENLGDWDRVRGIYTIALDENSDFLTKEAKIVLLQKYITFETESQEFEKARKLYRRYLEL
NQYSPQSWIEFAMYQTSTPTEQQLLDLAKLQSENVDEDIEFEITDENKLEARKVFEEAIV
FFKEKDDKQGRLSILEALKDYEETYGTELDQETVKKRFPKVIKKVRLQDGVEEEFVDYVF
PDDIDDDKPKPSKFLELAKKWKQEQAL
Download sequence
Identical sequences A0A0L8VLL4 B3LT82 C8ZD87
YLR117C SCRT_05100 YLR117C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]