SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_05324 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05324
Domain Number 1 Region: 206-558,629-802
Classification Level Classification E-value
Superfamily TPR-like 9.1e-50
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  SCRT_05324
Domain Number - Region: 948-1011,1038-1099
Classification Level Classification E-value
Superfamily PIN domain-like 0.00471
Family PIN domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_05324
Sequence length 1118
Comment | SCRG_05323 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (1119 aa)
Sequence
MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK
RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM
DVPKSPYYVNRTMLARNMEVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD
IRRAPVVDASPPPMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL
PKYLKLKKDKREKKRSEATETSSYTDPFDVQISSESYFQNIDALNSSFKDIPTNLNIWLD
SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH
FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK
CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI
AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNFTFKLDAYDEDNYNDNNELDDLYDTIEI
NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG
NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF
AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF
TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT
DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN
Download sequence
Identical sequences B3LTZ8
YIL151C SCRT_05324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]