SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SCRT_05388 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_05388
Domain Number 1 Region: 99-458
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.66e-106
Family Cystathionine synthase-like 0.00000000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_05388
Sequence length 458
Comment | SCRG_05387 | Saccharomyces cerevisiae RM11-1a cysteine desulfurase, mitochondrial precursor (458 aa)
Sequence
MLKSTATKSITRLSQVYNVPAATYRACLVSRRFYSPPAAGVKLDDNFSLETHTDIQAAAK
AQASARASASGTTPDAVVASGSTAMSHAYQENTGFGTRPIYLDMQATTPTDPRVLDTMLK
FYTGLYGNPHSNTHSYGWETNTAVENARAHVAKMINADPKEIIFTSGATESNNMVLKGVP
RFYKKTKKHIITTRTEHKCVLEAARAMMKEGFEVTFLNVDDQGLIDLKELEDAIRPDTCL
VSVMAVNNEIGVIQPIKEIGAICRKNKIYFHTDAAQAYGKIHIDVNEMNIDLLSISSHKI
YGPKGIGAIYVRRRPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGEAARLMKKEFDNDQ
AHIKRLSDKLVKGLLSAEHTTLNGSPDHRYPGCVNVSFAYVEGESLLMALRDIALSSGSA
CTSASLEPSYVLHALGKDDALAHSSIRFGIGRFSTEEE
Download sequence
Identical sequences B3LU60
SCRT_05388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]