SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_14.256 from Carica papaya

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  evm.TU.supercontig_14.256
Domain Number - Region: 25-112
Classification Level Classification E-value
Superfamily Tropomyosin 0.00948
Family Tropomyosin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_14.256
Sequence length 127
Sequence
MAEKEPEARDDLAESLNNLFTSVSTMVKSELEGTNNQLELLEKMNLRVAEEYEGFGDVAA
GLRLFVEQLKSKSGNFDAYVQQIDAIEQQVTEFEAVTSVLDRHVSLLESKVQSAYSHHLP
PPHHPPV
Download sequence
Identical sequences evm.TU.supercontig_14.256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]