SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_142.24 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_142.24
Domain Number 1 Region: 418-488
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000354
Family PHD domain 0.0069
Further Details:      
 
Domain Number 2 Region: 587-718
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000185
Family N-acetyl transferase, NAT 0.028
Further Details:      
 
Domain Number 3 Region: 161-257
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000216
Family MgtE N-terminal domain-like 0.017
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_142.24
Domain Number - Region: 488-533
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00336
Family PHD domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_142.24
Sequence length 790
Sequence
MNDTIIVKVEKVYRPEAIVQYLHRNARQEPPDLTLEAKKHLAALGWVFWYPKTIGKKKNL
RISSPAGNCYFSLREACEACIGQVNNSCIDFSTRRGRKRKQYQYSDKDSGERGDDQGKSL
NEPRRGKVVKNLNEPRRETVIENQNEPRRVKNLNEPRRGKVVKNLNEPRKETVIENLNEP
RRGKVVKNLNEPRRGKVVKNLNEPRRETVIENLNEPRRETVIENLNEPRRGKVVKNLNEP
RKGKVVKNLNEPRRETVIENLNEPRRGKVVKNLNEPRRGKVVKNLNEPRRETVIENLNEP
RRGKVVKNLNEPRTSRFEQETTPSSWRRKPKTVLSTLIDNRVVRIGDKVHYRGTSGCKNP
SAEGEISREGIKCSCCSKVFTLTGFESHTGNTNHRPAANILLEDGRSLSDCQAQLTAKKK
TETHEEIHRTATKRIKTRSDNKKDSICSICLFEGELILCDRCPAAFHQSCINDFSGFSNG
NWFCPLCICEICNQPMSEENDYRAISCDYCQTKYHNCCGQKTGKWFNLSWFCSTRCQEIF
LSIDNILGKPIHVEDKNLTWTLLKSIESHHFSNHLPDIEELRKNQQKLELALDVMHECFE
KTKDVYTGRDVAEEVIFSRGSELNRANFKGFCVAVVENEDDMVCAATVRIHGDVAEIPLV
ATRFRYQRRGMCRVLMKELEKQLWGIGVKRLILPALVEAVDTWVNYFGYSKMIESEKLAV
LDQRFLNFPGTVICQKFLKDIISANPLEKTRENRQHHNKVDDFDWCSFKNGSYPPKAMER
EVKNQTPILV
Download sequence
Identical sequences evm.TU.supercontig_142.24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]