SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_48.177 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_48.177
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily At5g01610-like 3.92e-39
Family At5g01610-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_48.177
Sequence length 169
Sequence
MSVVTEEIKAKAEYYQGDEICQEKSKLLLKEMSLPNGLLPLKDILECGYVKETGFVWLKQ
KNSTTHKFEKIGKLVSYATEVTAVVSPGKIKKLTGVKTKELLVWVSLSDIYTDDPPTGKI
TFRTPAGLFRSFPVSAFEIYPSIQFTVFGTGNLSRSNLGGLCWSSNGEQ
Download sequence
Identical sequences evm.TU.supercontig_48.177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]