SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_5.223 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_5.223
Domain Number 1 Region: 417-580
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.28e-42
Family BRCA2 helical domain 0.0006
Further Details:      
 
Domain Number 2 Region: 581-709
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-36
Family Single strand DNA-binding domain, SSB 0.00014
Further Details:      
 
Domain Number 3 Region: 713-742,860-946
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.8e-25
Family Single strand DNA-binding domain, SSB 0.0064
Further Details:      
 
Domain Number 4 Region: 743-860
Classification Level Classification E-value
Superfamily BRCA2 tower domain 7.46e-17
Family BRCA2 tower domain 0.0032
Further Details:      
 
Domain Number 5 Region: 950-1084
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000411
Family Single strand DNA-binding domain, SSB 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_5.223
Sequence length 1105
Sequence
MSTWQIFSDAGDNNFRWEISSGRVIPSKSDDRFINSGPPLPSMADLLLQAGSSKLLEIGE
REAEKLPLFRTALGKSVVLKESSIAKALSVLDDDGATSSGDMLRRDNGLVSLNSFFQTGS
GKSVNISSAGLVRAKKLLGLEEDNAHCNLQGECVRDLSDCTEQKGRDNLDTKEGTNNYGV
IDSSSFQMHSSSFKACLAGSDLNSEVNSTGMHYDILNSTPKMPPMKFHTAGGRSLSVSGD
ALKRARSLLGDPELGNFLDKMDADDSLRKSGGIQLNKEQDKYTPCSHQGTEKNVCVSRVF
ISPLQSFNKQLRSPFNSENLALGSNLIEKFEAVSDENICALSSSKSSRDEPLDVRSSALQ
SIINYSSKKGAGSRINPLGQSSCMPLTDISNHVGKVNINNKPTATEKRRLGSASSMSPFK
RPRSSKFSTPLNKTSKTVSNGLSSLSSERSCSRRVVSTRYPFQVPRVYIKEYFVLPPLAQ
SKLEHSLHQVRSDNADKYEFTDDSGNSIGAEGFFHMLVHSGASTQHVSKEWVRNHYKWIV
WKLACYDRCYPSKSTGKFLTLSNVLEELKYRYEREVNHGHRSAIKRILDGDASTSSMLVL
CISAVHLSCEQKIGNHSMETNGPDDKNLAQVELTDGWYSIGALLDILLSKQLHSGKLFVG
QKLRICGAGLSGWVGPISPLEASKSVSLLLNMNGTYRACWADRLGFCKSVGDPLAFRCIK
RNGGPVPCTLVGVTRVYPILYKERLTNGKSIVRSEKTEMKMMQLFNQRRSVIAEGILSEY
QRGPNSYPIHNDSDSEGAKILKILETAAEPEVLMAEMSPEQLTSFATYKAKLEASRQREI
EKTIEKALEDTGLREREVTPFVRVRVTGLTTGNHQGKSITKKEGMITIWNPTEKQQSELV
EGRVYVFKGLIPMNSDSETLYLQARGSTTQWEPVPPEAVQHFEPFFNPRKSVSLSKLGEV
PLSSEFDIAAWVLYVGEVYIDAQRRKQWVFVTDGSVSDIKSGEISNSLLAINFCSPCVDD
DSFLQINHNLAGSLVGFCDLVKKAKDQKNELWVAEATENSSYFLSFDFPRCSHLKSAAAS
VQRISSLSIQKLKEKVLFIIGECKD
Download sequence
Identical sequences evm.TU.supercontig_5.223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]