SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_57.14 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_57.14
Domain Number 1 Region: 92-308,665-704
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.99e-64
Family Tandem AAA-ATPase domain 0.000000722
Further Details:      
 
Domain Number 2 Region: 731-945
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 4.97e-60
Family Helical scaffold and wing domains of SecA 0.0000277
Further Details:      
 
Domain Number 3 Region: 444-549,642-725
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-47
Family Tandem AAA-ATPase domain 0.0000141
Further Details:      
 
Domain Number 4 Region: 308-430
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 6.67e-44
Family Pre-protein crosslinking domain of SecA 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_57.14
Sequence length 1021
Sequence
MVAPLRDLSLVNHCPSVSPSPLLFLFANSNFRQKHHVGSSFWGKKSLQLLKSEAKTSKLG
GCRKRRMRAMASLGGLLGGIFKGTDSGESTRQQYAATVDMINRLEHEISALSDSDLREKT
TILKDRVQQGESLDSLLPEAFAVVREASKRVLRLRPFDVQLIGGMVLHKGEISEMRTGEG
KTLVAILPAYLNALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNMTSEQRR
ENYLCDITYVTNSELGFDYLRDNLATESNSYFISCVDELVLRNFNYCIIDEVDSILIDEA
RTPLIISGPAEKPSDRYYKAAKIAAAFERDIHYTVDEKQKTVLLTEQGYEDAEEILDVKD
LYDPREQWASYVLNAIKAKELFLRDVNYIIRGKEVLIVDEFTGRVMQGRRWSDGLHQAVE
AKEGLPIQNETITLASISYQNFFLQDESDVVFRAATGKWRAVVVEISRMYKAGRPVLVGT
TSVEQSDSLSEQLREAGIPHEVLNAKPENVEREAEIVGQSGRLGAVTIATNMAGRGTDII
LGGNAEFMARLKLREILMPRVVKPVDGAFVSVKKPPPKKTWRVSESLFPCKLSNKNAKLA
EEAVDLAVKSWGQMSLTELEAEERLSYSCEKDKVISKLRSVFLEIVREYKVYTEEERKKV
VAAGGLHVVGTERHESRRIDNQLRGRSGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGLMR
AFRVEDLPIESKMLTKALDEAQRKVENYFFDIRKQLFEYDDVLNSQRDRVYTERRRALES
DDLQSLIIEYAELTMDDILEANIGPDAPKESWDLEKLIAKLQQYCYLLTDLTSDLLRSQC
SNYEELQDNLRLRGREAYLQKRDIVEKQAPGLMKEAERFLILSNIDRLWKEHLQALKFVQ
QAVSLRGYAQRDPLIEYKLEGYNLFLEMMAQIRRNVIYSIYQVCIKPCIKIRGISRKIHY
LICEKFSYFQFQPMLVKNDKEETQSEKSGKLVSNGRGGKKNPNPVGAAEPSASAASPQAS
A
Download sequence
Identical sequences evm.TU.supercontig_57.14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]