SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_7.101 from Carica papaya

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  evm.TU.supercontig_7.101
Domain Number - Region: 214-245
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00011
Family Rho termination factor, N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_7.101
Sequence length 249
Sequence
MGALLHFPPCFSFNKQPKLRWGEPTFLLREIADGCSTLPSRKAASFQFTVSSRRSDGNRR
GNPSQKNPASERKNEGQNKKPSENKITSSSNQEEIIALFNRIQSSISKKEPTSSKEINPK
PSEKKPSADSVLDLLHQFRKGIPDTMTEKARENKLKWRRAVAKEQKILNKETAVDFRLFR
PPSNFVKRSPIPSPSVPRGKILEMKKEPKEDAAAIEKLKLPELKQIAKSRGIKGYSRLKK
SELVKLLSS
Download sequence
Identical sequences evm.TU.supercontig_7.101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]