SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_1647.1 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_1647.1
Domain Number 1 Region: 188-417
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000425
Family Tropomyosin 0.0026
Further Details:      
 
Domain Number 2 Region: 394-597
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000948
Family Tropomyosin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_1647.1
Sequence length 1414
Sequence
MDAKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGVLRQ
AHRTMAEAFPNQVPLMFGDDSPAGPLIMEDPVTPEMPALIRASFDPDELPKDALGLSPSH
LHTVKRNGAFTDEHDSVTTRKGLKQLNDLFGSGDGKARKGLKFHDAEETGRNVKSNWSPN
IQAQVLSDSEQVGKAETEIIALKDALAKLEAEKEASLLQYQQSLERLSNLESEVSHAQEE
SVGLNERARKAEAEVQTLKEALTKLEAEREASLLQYQQCMEKITHLENSISNAQKDIGEL
NERASKAETENQALKEDLVEVETEKEAALIQCEKCLEMISDLNEKLRHAEEDARRTEVQA
EKAEEDVEILKQALSRLTEEKDASALQYQLCMETIANLEHNLASAQEEVERLTHDIEDGL
VKLNDAEGRCLVLETSNQSLHSELESLVQKMGSQSQELTEKQKELGRLWTCIQEERLRFV
EAETAFQTLQHLHSQSQEELRSLATELQNRAQILKDMETHNRDLHDEVQKVKEENKDLNE
LNLSSAMSIKNLQDEILSLKKTIGKLEAEVELRVDQRNALQQEIYCLREELNELSKQNKA
MTDQVESVGLDPDCFGSSVKELQDENLNLKESTEKERSEKAELVEKLELMQKLVEKNALL
ENSISDLNDELEGIRQRVKELEESCQSLMGEKSNLTAEKNTLTCQLQIANENLEKLSEKK
DFLENSLFDANAELEGVRVKLKSLEDFCLLLDNKNSDLTTERESLLSQLEITRKSLEDLE
KEYGELEGKYLALDKEKESAYQKMEELGVSLDAKNQEYASFTQLSETQMVDMEQRICLLQ
EDSQCRKKEYEKELDKSLNAKIEIFIFQKCVKDLEEKNFSLFAECQRFVEASKLSGKLIS
DLECENHQYKLEMKSLVDRIQLLRMGLHKVFNTLKIDAELGYEDKLEHDQTIMHHILSRF
QELQNSLSKIQDENHQAVIETSVLVALLRQLKIEAEDLASEKNIVAKEFNIQSKQIISLQ
SEIQKLMQINEELRLKVAEGDCKEEALKTEIEHFRGQLSHLGGICNNLQEENCKMIDQKS
SLMNSVVMLEEEKRNLEEENFLIFSETVCQSSVSLIFKDILAEKLVEMQELSENLVKLHS
INDGLGEKVRMMERELEDIQMESSKLKESLEISNHELFSVGSVRDKLTCEILNGKDLLSQ
KEKELLEAEQKLAAAENDRTELYELVEALKFKYNKITGIEEDQKRQISKLSGDCNHQIKE
AERLREANGKLNTELSKLQFELKEIKHEVERLRDELLKERTELELWETEAAAFFGELQIS
IVHEALLEGKTSELNKACKMFEDKSMSKDIEIDKLSGKVSTLEGENKGLKTKLATYAPAI
IFLKDSISSLENHALLHAHLYKPEGEVEKVITFP
Download sequence
Identical sequences evm.TU.supercontig_1647.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]