SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_173.19 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_173.19
Domain Number 1 Region: 116-186
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-25
Family B3 DNA binding domain 0.03
Further Details:      
 
Domain Number 2 Region: 346-406
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000012
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_173.19
Sequence length 453
Sequence
MAYSAPNHTSGGPHTGPASDALYKELWHACAGPLVTLPREGERVYYFPQGHMEQLEASMN
QDAEQQMPSFNLPSKILCKVVNIQRKAEPETDEVYAQITLLPDPDQSEVTSPDPPLPEPE
RCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHGSEWHFR
HIFRGMWKSSIESPAFSYSDSQRVGDRYSSPKFSSAAKANSFCFSGNGSPAAVSSNSMQW
PNRVDGALESFSPVINKESVEGKQGNGNGYRLFGIQLVDNANVGESSPVVTVSGIMGEDR
YVDADSDQHSEPSNINRSDIPSVSCDIEKSSLRSPQESQSRQIRSCTKVHMQGIAVGRAV
DLTRFDCYDDLSQEAGRNVVYTDDEDDMMMVGDEPWHEFCSIVRKIYIYTSEEVKKLSPK
TKFLVNEEVKPVKLDTDVAVNTEDRSSIVGSGC
Download sequence
Identical sequences evm.TU.supercontig_173.19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]