SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_5.157 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_5.157
Domain Number 1 Region: 180-417
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 5.23e-87
Family Type II DNA topoisomerase 0.00028
Further Details:      
 
Domain Number 2 Region: 26-176
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.67e-45
Family DNA gyrase/MutL, second domain 0.000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_5.157
Sequence length 422
Sequence
MSMIFFGDKKRRKREGDKHPPTKERQTRKEVNGILLDVALQWCSDAYSDTMLGYANSIRT
VDGGTHIDGVKASLTRTLNSLGKKSKVIKDKEINLSGEHVREGLTCIVSVKVPNPEFEGQ
TKTRLGNPEVRRMVDQSVQEYLTEYLELHPDVLDSILSKSLNAFKAAPAAKRARELVRSK
SVLKSSSLPGKLADCSSTNPEESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVER
KDETAMYKNEEIQNLILALGLGVKGEDFKKENLRYHKIIILTDADVDGAHIRTLLLTFFF
RYQRALFDEGCIYVGVPPLYKVERGKQVYYCYDDADLKKLQSSFPQNASYHIQRFKGLGE
MMPAQLWETTMNPEQRLLKQLMVEDAAEANVIFSSLMGARVDVRKELIQSSANRINVEQL
DI
Download sequence
Identical sequences evm.TU.supercontig_5.157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]