SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_50.119 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_50.119
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily POZ domain 6.28e-17
Family BTB/POZ domain 0.014
Further Details:      
 
Domain Number 2 Region: 250-364
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.54e-16
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_50.119
Sequence length 594
Sequence
MENGSEMSSSLSFASSNLSSSSSSLSHDPCTSLENLSLNKLSCNLENLLFHSEYDYSDAE
IVVEDKPVAVHRCILAARSQFFHQLFSKGVVKEGKPRYLMSELVPFGVVGYEAFSVFLNY
LYTGKLRPSPPEVSTCVDLTCNHDACGPAITYALELMYASATFQVKELVLLLQRRLLDFV
EKAFVEDVIPILVAAFHCQLNQLLSNCIQRVARSDIDCACLSKELPSEVFSKLKSVRLEI
QQDHESSDLEVDAVDEKSIKKIHMALDSDDVELVNRLLSESNITLDKAYALHYAAAYCDP
KVVKELLRLGLADLSLRNPRGLTVLHVAARRKEPSLLMALLTEGASVSGTTLDGQTAVAI
CRRLTRLKDYNKNIEQGQVSHKDRICIGILEREMGNSVSGNVPISSPMNTDDLQRTLDYL
EDRVAFARLFFPAEAKLAMEIADASLSSANAGLSASKSMGSSGNLRDVDLNETHTVWTKR
LQLQLQKLHKTVETGRRYFPHCSDVLDNFLEDAEMPDSLFLEKGTPEEQKLKKRRFMELK
EDVQKAFNKDMENKRSGLARVSSFFIILNFSRSRFVVAFLVVVVLVDFFTSKMR
Download sequence
Identical sequences evm.TU.supercontig_50.119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]