SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_80.116 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_80.116
Domain Number 1 Region: 212-311
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000863
Family B3 DNA binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  evm.TU.supercontig_80.116
Domain Number - Region: 19-69
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0167
Family Ribonuclease H 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_80.116
Sequence length 319
Sequence
MHTIGYKSNVWLAPSFGEIKFNIDASALGKLGLTMVGGVLRNAQGFMKCMFSTIVGVMDL
NQAELLAINEPSLSWLLTTGLGTILLLWKVTPLWLGWIKNNSILWRLNSVANSIVNGCGQ
VESDSYSILNETNIGMMGPGAPAHAVGPTPEIGEQFHGASLYGADLFHEDDMYSQIEEET
SGWNLLYPHNLPEITSGRLPEININSKPALIPLFEKVLVPSDADPCRGMLFLPKLYSEIY
FPELPLGQKMPLLVQDITGVNWQFVYGVWWMNGRKIYVLEGFDGYMTLMGLKPGDKVTFY
RTEPEKKLIIRLQKAPDNK
Download sequence
Identical sequences evm.TU.supercontig_80.116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]