SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ERM95854 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERM95854
Domain Number 1 Region: 103-350
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.71e-69
Family Glutamine synthetase catalytic domain 0.0032
Further Details:      
 
Domain Number 2 Region: 14-102
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 7.85e-18
Family Glutamine synthetase, N-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ERM95854
Sequence length 356
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00060:1383064:1386882:-1 gene:AMTR_s00060p00109730 transcript:ERM95854 description:"hypothetical protein"
Sequence
MSLLTDLINLNLSDSTEKVIAEYIWIGGSGMDLRSKGRTLSGPENDPSKLPKWNYDGSST
GQAPGEDSEVILYPQAIFPDPFRRGKNILVMCDAYTPAGEPIPTNKRYNAAKIFSHPDVV
AEEPWYGIEQEYTLLQKDTNWPIGWPIGGFPGPQGPYYCGIGADKAFGRDIVNAHYKACL
YAGINMSGINGEVMPGQWEFQVGPSVGISSGDQIWVARYILERIAEIAGVVVSFDPKPIP
GDWNGAGCHSNYSTKSMRSDGGFDVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETAD
INTFSWGVANRGASIRVGRETEREGKGYFEDRRPASNMDPYVVTSKIAETTVLWKP
Download sequence
Identical sequences W1NKU0
ERM95854 XP_006828438.1.86515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]