SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ERM94653 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERM94653
Domain Number 1 Region: 109-201
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000961
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ERM94653
Sequence length 228
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00011:3932864:3933704:1 gene:AMTR_s00011p00207030 transcript:ERM94653 description:"hypothetical protein"
Sequence
MDLFDRERMRKETGETEIVVEGGEKAKVMDLSFKVRRVNNNWVMLPNPRKKLYESSSGEK
PEWGTSAESSCRGEKMEAKICPESFAEIVANPSELPMKIIVDLVRRYWPNPWFNKVIMSE
DVHPRRPVLRIPKEGVESQMWITNRWERRAIKDGISIPMIIGDLASVVETQVRFETCEIS
HKLVIKEGWKGITKSFNLKAAVHKICFAIYHDGESKLRILARIRDNIF
Download sequence
Identical sequences W1NGP5
ERM94653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]