SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ERM94654 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERM94654
Domain Number 1 Region: 101-193
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000883
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ERM94654
Sequence length 220
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00011:3947913:3948730:1 gene:AMTR_s00011p00207260 transcript:ERM94654 description:"hypothetical protein"
Sequence
MRKETGETEIVVEGGEKAKVMDLSFKVRRVNNNWVMYPNPRKRLYESSSGEKPEWGTSAE
SSCRGEKMEAKICPESFAEIVAKPSELPMKIIVDLVRRYWPNPWFNKVIMSEDVHLRRLV
LRIPKEGVESLMWITNRWERRAIKDGISIPMIIGDLASVVETQVRFETCEISHKLVIKEG
WKGITKSFNLKAAVHKICFAIYHDDESKLRILARIRDNIL
Download sequence
Identical sequences W1NHJ3
ERM94654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]