SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ERM99168 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERM99168
Domain Number 1 Region: 20-495
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.43e-141
Family Pyridoxal-dependent decarboxylase 0.00000000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ERM99168
Sequence length 506
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00092:539985:541505:1 gene:AMTR_s00092p00055440 transcript:ERM99168 description:"hypothetical protein"
Sequence
MGSLPEIFDSSAMAASHPLDPEDFRKQAHIMVDFIADYYQDVEKLPVRSEVKPGYLRHCL
PDSAPYNPEPLENILEDVKSHIVPGITHWMSPNYFAYFPSSGSTAGFLGEMLSTGFNVVG
FNWLSSPAATELESIVIDWIGKMLCLPKSFLFSGGGGGVLQGTTCEAILCTLAAARDRKL
KKIGGDKIGQLVVYASDQTHCALQKAAQIAGIRPENFRAVPTTKACNFGLSPAALRRAME
EDVAAGLVPLYACATIGTTSSTAVDPLEGLGRVTRDFGVWLHVDAAYAGSACICPEFRHF
LDGVELADSYSMNAHKWFFTNLDCCCLWVKNPDALVQSLSTNPEYLRNKATESKMVVDYK
DWQIALSRRFRALKLWMVLRSYGVSNLRNFLRSHVRMAKQFEGLVNADPRFEIVVPRTFA
MVCFRLTPPTGSRWETDNGEELNKELLEAVNSTGLAYMTHAVVGGVYMIRFATGGTLTEE
RHISAAWRLVQEQAEALVGTYKAKEV
Download sequence
Identical sequences W1NV50
XP_006836315.1.86515 ERM99168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]