SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ERN04194 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERN04194
Domain Number 1 Region: 206-293,435-572
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.19e-26
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 
Domain Number 2 Region: 289-360,393-430
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-17
Family Calcium ATPase, transduction domain A 0.012
Further Details:      
 
Domain Number 3 Region: 565-603
Classification Level Classification E-value
Superfamily HAD-like 0.00000824
Family Meta-cation ATPase, catalytic domain P 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ERN04194
Sequence length 682
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00077:1450910:1453586:-1 gene:AMTR_s00077p00113350 transcript:ERN04194 description:"hypothetical protein"
Sequence
MTSGQPLLFSQNASDSLSLDAPPPLKRGSFSCLCRTGSVSSSHVSSTFSDLDDAQSHFVD
AKNESLSRRKLSWDVASIGERDLGRNLYESECTFPTTRFQSAESQFFQHVLSECHSQPAQ
SVSAFSGHHMEHDKSSDLLSRSALEISSGPSMYIPTDTASSSRREKLNHQRTRRKSWANE
DILSSEENARFIHINDPRRTNDKYEFTGNEIRTSKYTVITFLPKNLFIQFHRVAYIYFLV
IAALNQLPPLAVFGRTVSLFPLLFVLFVTAIKDGYEDWRRHRSDRKENNREAKVLQGARF
YSKEWKKIRVGEILKIHADETIPCDMVLLRSSDPSGIAYVQTMNLDGESNLKTRYARQET
ASTDYESEHVTGLIRCEQPNRNIYEFTANMEFGGQRIPLGQSNIVLRGCQLKNTDWIIGV
VVYAGQETKAMLNSAISPSKRSKLEGYMNRETLWLSVFLFVMCAVVAFGMGLWLERHMDR
LDTLPFYRRKYFTKGQENGKRYNYYGLPLEIFFSFLSSVIVFQIMIPISLYISMELVRLG
QSYFMIGDTRMYDCSSDSRFQCRSLNINEDLGQIRYVFCDKTGTLTENKMEFRKASIHGQ
NYGNSSYLADQQMQDTSEGRPGKGGIAGMKFCLMIYTDNHRDLCTENAGIRYYQKFNNVE
KSTRCSLGGHGVVQLPRHDAGN
Download sequence
Identical sequences W1P962
ERN04194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]