SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ERN14825 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERN14825
Domain Number 1 Region: 72-145,201-230
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000314
Family BTB/POZ domain 0.026
Further Details:      
 
Domain Number 2 Region: 279-375
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000482
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ERN14825
Sequence length 595
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00032:1437542:1445696:1 gene:AMTR_s00032p00112510 transcript:ERN14825 description:"hypothetical protein"
Sequence
MENPTESSCSRSFASSSYVSNGSSCANHSVCNGSEPGSCMTGSQRNTTPGPEINGLMRLS
TNLENLLHEPYNGFSDAEIEVEGVPIGVHRCILAARSSVFREVFSREKKHEGKPKYSIEE
LVPSGKVGYEAFRIVLNYLYTGRLKSAPPEVSTCVEKVCAHDDCRPAVDFAVEVVRASAV
FQIQELGSVWQRRLLSYVEKAQVEDVIPILLVASSCHLSPLDTHCIQRMARSDLDDISLE
KSFSREIVEEILSLRLKSRIDDEPLSPKKDPLQLKNFKRIHKALDSDDLELVKMLLMEGN
TTLDDAEALHYAAAYCDSKVVAELLELGGADVNKRNSRGYTVLHVAAMRQEPAVLVALLS
KEARACELTSDGRSGARICRRLTTPKDYNTHTEQGQESRKEKMCIDILEREERRNPLVEN
VSASAMVSPEELHMKLLYLENRVAFARVLFPTEAKLAMDNAQAGATTEFAGHSPSTSSRG
TLGPVDLNETPTSVIKKMYSRMAALQRTVDMGRRYFPHCSEVLDKLMEDDMSDLLFLENG
TLEEQRVKRQRFNEVKDDVQKAFTKDQVLAKSGTSSSSSTSSLKDRLRHRPGVKK
Download sequence
Identical sequences U5CXX0
XP_020528413.1.86515 ERN14825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]